PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.007G099900.1
Common NamePHAVU_007G099900g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family MYB
Protein Properties Length: 279aa    MW: 32559.7 Da    PI: 6.3473
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.007G099900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.99.6e-181562148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        rg+W++eEd++l ++v+ +G g W+  +++ g++R++k+c++rw++yl
  Phvul.007G099900.1 15 RGPWSAEEDKILMNYVQVHGEGKWRELSKRAGLKRCGKSCRLRWLNYL 62
                        89********************************************97 PP

2Myb_DNA-binding52.61e-1668113148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         rg+ + +E++l+++++k+lG++ W++Ia +++ gRt++++k++w++yl
  Phvul.007G099900.1  68 RGNISSDEEDLIIRLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNTYL 113
                         78999*****************.*********.*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.5761062IPR017930Myb domain
SuperFamilySSF466894.21E-3013109IPR009057Homeodomain-like
SMARTSM007174.1E-141464IPR001005SANT/Myb domain
PfamPF002492.1E-161562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.0E-241669IPR009057Homeodomain-like
CDDcd001671.26E-101762No hitNo description
PROSITE profilePS5129426.10263117IPR017930Myb domain
SMARTSM007175.4E-1667115IPR001005SANT/Myb domain
PfamPF002494.9E-1568113IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.0E-2570117IPR009057Homeodomain-like
CDDcd001676.73E-1172113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MERKANCENE YAMNRGPWSA EEDKILMNYV QVHGEGKWRE LSKRAGLKRC GKSCRLRWLN  60
YLNPDIKRGN ISSDEEDLII RLHKLLGNRW SLIAGRLPGR TDNEIKNYWN TYLRKKVEQK  120
YNQNHVVGHD SNIPINLSSK NFLDDVLDPT KPPHPMMITP KSMRCTKVMM PGNDSVSTMN  180
LITTTRDHNN PSASMSQDHH NHCLTGVFQD FDISDLLMSY EDDCRFNGYA CVEIPERTFE  240
DETWRLDDSM VGEAWYENWK HDSYFSQEQD MVMGFSFF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-291311725128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150410.0AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007143768.10.0hypothetical protein PHAVU_007G099900g
TrEMBLV7BD430.0V7BD43_PHAVU; Uncharacterized protein
STRINGGLYMA10G35061.11e-153(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15511512
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13540.11e-58myb domain protein 5